Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [64074] (2 PDB entries) |
Domain d1g5hc1: 1g5h C:343-459 [60274] Other proteins in same PDB: d1g5ha2, d1g5ha3, d1g5hb2, d1g5hb3, d1g5hc2, d1g5hc3, d1g5hd2, d1g5hd3 complexed with gol, na |
PDB Entry: 1g5h (more details), 1.95 Å
SCOPe Domain Sequences for d1g5hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5hc1 c.51.1.1 (C:343-459) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} rkvlklhpclapikvaldvgkgptvelrqvcqgllnellengisvwpgysetvhssleql hskydemsvlfsvlvtettlengliqlrsrdttmkemmhisklrdflvkylasasnv
Timeline for d1g5hc1: