Lineage for d1g5hc1 (1g5h C:343-459)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135875Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2135876Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2135877Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2135947Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species)
  7. 2135955Species Mouse (Mus musculus) [TaxId:10090] [64074] (2 PDB entries)
  8. 2135958Domain d1g5hc1: 1g5h C:343-459 [60274]
    Other proteins in same PDB: d1g5ha2, d1g5ha3, d1g5hb2, d1g5hb3, d1g5hc2, d1g5hc3, d1g5hd2, d1g5hd3
    complexed with gol, na

Details for d1g5hc1

PDB Entry: 1g5h (more details), 1.95 Å

PDB Description: crystal structure of the accessory subunit of murine mitochondrial polymerase gamma
PDB Compounds: (C:) mitochondrial DNA polymerase accessory subunit

SCOPe Domain Sequences for d1g5hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5hc1 c.51.1.1 (C:343-459) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
rkvlklhpclapikvaldvgkgptvelrqvcqgllnellengisvwpgysetvhssleql
hskydemsvlfsvlvtettlengliqlrsrdttmkemmhisklrdflvkylasasnv

SCOPe Domain Coordinates for d1g5hc1:

Click to download the PDB-style file with coordinates for d1g5hc1.
(The format of our PDB-style files is described here.)

Timeline for d1g5hc1: