Lineage for d1g5hb2 (1g5h B:40-332)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967618Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2967805Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain [64349] (2 species)
  7. 2967811Species Mouse (Mus musculus) [TaxId:10090] [64350] (2 PDB entries)
  8. 2967817Domain d1g5hb2: 1g5h B:40-332 [60273]
    Other proteins in same PDB: d1g5ha1, d1g5ha3, d1g5hb1, d1g5hb3, d1g5hc1, d1g5hc3, d1g5hd1, d1g5hd3
    complexed with gol, na
    has additional insertions and/or extensions that are not grouped together

Details for d1g5hb2

PDB Entry: 1g5h (more details), 1.95 Å

PDB Description: crystal structure of the accessory subunit of murine mitochondrial polymerase gamma
PDB Compounds: (B:) mitochondrial DNA polymerase accessory subunit

SCOPe Domain Sequences for d1g5hb2:

Sequence, based on SEQRES records: (download)

>d1g5hb2 d.104.1.1 (B:40-332) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
realvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqv
favdslhqepgssqprdsafrlvspesireilqdrepskeqlvaflenllktsgklratl
lhgalehyvncldlvnrklpfglaqigvcfhpvsnsnqtpssvtrvgekteaslvwftpt
rtssqwldfwlrhrllwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwn
lgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlae

Sequence, based on observed residues (ATOM records): (download)

>d1g5hb2 d.104.1.1 (B:40-332) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
realvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqv
favdslhqepgrdsafrlvspesireilqdrepskeqlvaflenllktsgklratllhga
lehyvncldlvnrklpfglaqigvcfhpvsrvgekteaslvwftptrtssqwldfwlrhr
llwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgnv
stiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlae

SCOPe Domain Coordinates for d1g5hb2:

Click to download the PDB-style file with coordinates for d1g5hb2.
(The format of our PDB-style files is described here.)

Timeline for d1g5hb2: