Lineage for d1g4pb1 (1g4p B:1014-1235)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091291Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families) (S)
    automatically mapped to Pfam PF02581
  5. 2091292Family c.1.3.1: Thiamin phosphate synthase [51392] (2 proteins)
  6. 2091293Protein Thiamin phosphate synthase [51393] (2 species)
  7. 2091294Species Bacillus subtilis [TaxId:1423] [51394] (9 PDB entries)
  8. 2091311Domain d1g4pb1: 1g4p B:1014-1235 [60246]
    Other proteins in same PDB: d1g4pa2, d1g4pb2
    complexed with fqp, mg

Details for d1g4pb1

PDB Entry: 1g4p (more details), 2.5 Å

PDB Description: thiamin phosphate synthase
PDB Compounds: (B:) thiamin phosphate synthase

SCOPe Domain Sequences for d1g4pb1:

Sequence, based on SEQRES records: (download)

>d1g4pb1 c.1.3.1 (B:1014-1235) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
mtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearik
faekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvaaht
msevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggitidn
aapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr

Sequence, based on observed residues (ATOM records): (download)

>d1g4pb1 c.1.3.1 (B:1014-1235) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
mtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearik
faekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvaaht
msevkqaeedgadyvglgpiypravqgvslieavrrqgisipivgiggitidnaapviqa
gadgvsmisaisqaedpesaarkfreeiqtyktgr

SCOPe Domain Coordinates for d1g4pb1:

Click to download the PDB-style file with coordinates for d1g4pb1.
(The format of our PDB-style files is described here.)

Timeline for d1g4pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4pb2