Lineage for d1g4pa1 (1g4p A:14-234)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827813Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families) (S)
    automatically mapped to Pfam PF02581
  5. 2827814Family c.1.3.1: Thiamin phosphate synthase [51392] (2 proteins)
  6. 2827815Protein Thiamin phosphate synthase [51393] (2 species)
  7. 2827816Species Bacillus subtilis [TaxId:1423] [51394] (9 PDB entries)
  8. 2827832Domain d1g4pa1: 1g4p A:14-234 [60245]
    Other proteins in same PDB: d1g4pa2, d1g4pb2
    complexed with fqp, mg

Details for d1g4pa1

PDB Entry: 1g4p (more details), 2.5 Å

PDB Description: thiamin phosphate synthase
PDB Compounds: (A:) thiamin phosphate synthase

SCOPe Domain Sequences for d1g4pa1:

Sequence, based on SEQRES records: (download)

>d1g4pa1 c.1.3.1 (A:14-234) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
mtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearik
faekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvaaht
msevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggitidn
aapviqagadgvsmisaisqaedpesaarkfreeiqtyktg

Sequence, based on observed residues (ATOM records): (download)

>d1g4pa1 c.1.3.1 (A:14-234) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
mtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearik
faekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvaaht
msevkqaeedgadyvglgpiyptravqgvslieavrrqgisipivgiggitidnaapviq
agadgvsmisaisqaedpesaarkfreeiqtyktg

SCOPe Domain Coordinates for d1g4pa1:

Click to download the PDB-style file with coordinates for d1g4pa1.
(The format of our PDB-style files is described here.)

Timeline for d1g4pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4pa2