Lineage for d1g1ud_ (1g1u D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 50845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 50846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (14 proteins)
  6. 50922Protein Retinoid-X receptor (RXR-alpha) [48510] (2 species)
  7. 50923Species Human (Homo sapiens) [TaxId:9606] [48511] (6 PDB entries)
  8. 50936Domain d1g1ud_: 1g1u D: [60207]

Details for d1g1ud_

PDB Entry: 1g1u (more details), 2.5 Å

PDB Description: the 2.5 angstrom resolution crystal structure of the rxralpha ligand binding domain in tetramer in the absence of ligand

SCOP Domain Sequences for d1g1ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1ud_ a.123.1.1 (D:) Retinoid-X receptor (RXR-alpha) {Human (Homo sapiens)}
pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaph

SCOP Domain Coordinates for d1g1ud_:

Click to download the PDB-style file with coordinates for d1g1ud_.
(The format of our PDB-style files is described here.)

Timeline for d1g1ud_: