Lineage for d1g1ub_ (1g1u B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776945Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 776946Species Human (Homo sapiens) [TaxId:9606] [48511] (18 PDB entries)
    Uniprot P19793 227-458
  8. 776968Domain d1g1ub_: 1g1u B: [60205]

Details for d1g1ub_

PDB Entry: 1g1u (more details), 2.5 Å

PDB Description: the 2.5 angstrom resolution crystal structure of the rxralpha ligand binding domain in tetramer in the absence of ligand
PDB Compounds: (B:) Retinoic acid receptor RXR-alpha

SCOP Domain Sequences for d1g1ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1ub_ a.123.1.1 (B:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaph

SCOP Domain Coordinates for d1g1ub_:

Click to download the PDB-style file with coordinates for d1g1ub_.
(The format of our PDB-style files is described here.)

Timeline for d1g1ub_: