SCOP 1.57: Domain d1g15a_: 1g15 A:

Lineage for d1g15a_ (1g15 A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (6 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein RNase H (RNase HI) [53100] (2 species)

7. Species Escherichia coli [TaxId:562] [53101] (22 PDB entries)

8. Domain d1g15a_: 1g15 A: [60197]

Details for d1g15a_

PDB Entry: 1g15, 1.9 Å

PDB Description: co-crystal of e. coli rnase hi with two mn2+ ions bound in the the active site

SCOP Domain Sequences for d1g15a_:

Sequence, based on SEQRES records:

>d1g15a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealkeh
aevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewvk
ghaghpeneradelaraaamnptledtgyq

Sequence, based on observed residues (ATOM records):

>d1g15a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealkeh
aevilstdsqyvrqgitqwihnwkargwkpvknvdlwqrldaalgqhqikwewvghpene
radelaraaamnptledtgyq

Timeline for d1g15a_:

• d1g15a_ is new in SCOP 1.57
  
• d1g15a_ appears in SCOP 1.59
  
• d1g15a_ appears in the current release, SCOPe 2.08