SCOPe 2.06: Domain d1g0hb_: 1g0h B:

Lineage for d1g0hb_ (1g0h B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
   N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet

4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families)

5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)

6. Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (4 species)

7. Species Methanococcus jannaschii [TaxId:2190] [56666] (3 PDB entries)
   MJ0109
   structural genomics

8. Domain d1g0hb_: 1g0h B: [60172]
   complexed with ca, ipd

Details for d1g0hb_

PDB Entry: 1g0h, 2.3 Å

PDB Description: crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase

PDB Compounds: (B:) inositol monophosphatase

SCOPe Domain Sequences for d1g0hb_:

Sequence; same for both SEQRES and ATOM records:

>d1g0hb_ e.7.1.1 (B:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Methanococcus jannaschii [TaxId: 2190]}
mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
skemldiildll

Timeline for d1g0hb_:

• d1g0hb_ first appeared in SCOP 1.57
  
• d1g0hb_ appears in SCOPe 2.05
  
• d1g0hb_ appears in SCOPe 2.07
  
• d1g0hb_ appears in the current release, SCOPe 2.08