SCOP 1.69: Domain d1g0da3: 1g0d A:584-684

Lineage for d1g0da3 (1g0d A:584-684)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Red sea bream (Chrysophrys major) [TaxId:143350] [63674] (1 PDB entry)

8. Domain d1g0da3: 1g0d A:584-684 [60168]
   Other proteins in same PDB: d1g0da1, d1g0da4

Details for d1g0da3

PDB Entry: 1g0d, 2.5 Å

PDB Description: crystal structure of red sea bream transglutaminase

SCOP Domain Sequences for d1g0da3:

Sequence; same for both SEQRES and ATOM records:

>d1g0da3 b.1.5.1 (A:584-684) Transglutaminase, two C-terminal domains {Red sea bream (Chrysophrys major)}
tpellvqvpgkavvwepltayvsftnplpvplkggvftlegagllsatqihvngavapsg
kvsvklsfspmrtgvrkllvdfdsdrlkdvkgvttvvvhkk

Timeline for d1g0da3:

• d1g0da3 first appeared in SCOP 1.57
  
• d1g0da3 appears in SCOP 1.67
  
• d1g0da3 appears in SCOP 1.71
  
• d1g0da3 appears in the current release, SCOPe 2.08