Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Red sea bream (Chrysophrys major) [TaxId:143350] [63674] (1 PDB entry) |
Domain d1g0da3: 1g0d A:584-684 [60168] Other proteins in same PDB: d1g0da1, d1g0da4 complexed with so4 |
PDB Entry: 1g0d (more details), 2.5 Å
SCOP Domain Sequences for d1g0da3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0da3 b.1.5.1 (A:584-684) Transglutaminase, two C-terminal domains {Red sea bream (Chrysophrys major)} tpellvqvpgkavvwepltayvsftnplpvplkggvftlegagllsatqihvngavapsg kvsvklsfspmrtgvrkllvdfdsdrlkdvkgvttvvvhkk
Timeline for d1g0da3: