Lineage for d1g0da3 (1g0d A:584-684)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55006Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 55007Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 55008Protein Transglutaminase, two C-terminal domains [49311] (2 species)
  7. 55038Species Red sea bream (Chrysophrys major) [TaxId:143350] [63674] (1 PDB entry)
  8. 55040Domain d1g0da3: 1g0d A:584-684 [60168]
    Other proteins in same PDB: d1g0da1, d1g0da4

Details for d1g0da3

PDB Entry: 1g0d (more details), 2.5 Å

PDB Description: crystal structure of red sea bream transglutaminase

SCOP Domain Sequences for d1g0da3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0da3 b.1.5.1 (A:584-684) Transglutaminase, two C-terminal domains {Red sea bream (Chrysophrys major)}
tpellvqvpgkavvwepltayvsftnplpvplkggvftlegagllsatqihvngavapsg
kvsvklsfspmrtgvrkllvdfdsdrlkdvkgvttvvvhkk

SCOP Domain Coordinates for d1g0da3:

Click to download the PDB-style file with coordinates for d1g0da3.
(The format of our PDB-style files is described here.)

Timeline for d1g0da3: