Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (17 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
Species Red sea bream (Chrysophrys major) [TaxId:143350] [63667] (1 PDB entry) |
Domain d1g0da1: 1g0d A:6-140 [60166] Other proteins in same PDB: d1g0da2, d1g0da3, d1g0da4 complexed with so4 |
PDB Entry: 1g0d (more details), 2.5 Å
SCOP Domain Sequences for d1g0da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0da1 b.1.18.9 (A:6-140) Transglutaminase N-terminal domain {Red sea bream (Chrysophrys major)} glivdvngrshennlahrtreidrerlivrrgqpfsitlqcsdslppkhhlelvlhlgkr devvikvqkehgardkwwfnqqgaqdeilltlhspanavighyrlavlvmspdghivera dkisfhmlfnpwcrd
Timeline for d1g0da1: