Lineage for d1g0da1 (1g0d A:6-140)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223518Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 223519Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 223547Species Red sea bream (Chrysophrys major) [TaxId:143350] [63667] (1 PDB entry)
  8. 223548Domain d1g0da1: 1g0d A:6-140 [60166]
    Other proteins in same PDB: d1g0da2, d1g0da3, d1g0da4
    complexed with so4

Details for d1g0da1

PDB Entry: 1g0d (more details), 2.5 Å

PDB Description: crystal structure of red sea bream transglutaminase

SCOP Domain Sequences for d1g0da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0da1 b.1.18.9 (A:6-140) Transglutaminase N-terminal domain {Red sea bream (Chrysophrys major)}
glivdvngrshennlahrtreidrerlivrrgqpfsitlqcsdslppkhhlelvlhlgkr
devvikvqkehgardkwwfnqqgaqdeilltlhspanavighyrlavlvmspdghivera
dkisfhmlfnpwcrd

SCOP Domain Coordinates for d1g0da1:

Click to download the PDB-style file with coordinates for d1g0da1.
(The format of our PDB-style files is described here.)

Timeline for d1g0da1: