Lineage for d1g0da1 (1g0d A:6-140)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105192Protein Transglutaminase N-terminal domain [49235] (2 species)
  7. 105208Species Red sea bream (Chrysophrys major) [TaxId:143350] [63667] (1 PDB entry)
  8. 105209Domain d1g0da1: 1g0d A:6-140 [60166]
    Other proteins in same PDB: d1g0da2, d1g0da3, d1g0da4

Details for d1g0da1

PDB Entry: 1g0d (more details), 2.5 Å

PDB Description: crystal structure of red sea bream transglutaminase

SCOP Domain Sequences for d1g0da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0da1 b.1.1.5 (A:6-140) Transglutaminase N-terminal domain {Red sea bream (Chrysophrys major)}
glivdvngrshennlahrtreidrerlivrrgqpfsitlqcsdslppkhhlelvlhlgkr
devvikvqkehgardkwwfnqqgaqdeilltlhspanavighyrlavlvmspdghivera
dkisfhmlfnpwcrd

SCOP Domain Coordinates for d1g0da1:

Click to download the PDB-style file with coordinates for d1g0da1.
(The format of our PDB-style files is described here.)

Timeline for d1g0da1: