SCOP 1.59: Domain d1fzoa1: 1fzo A:182-274

Lineage for d1fzoa1 (1fzo A:182-274)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (15 PDB entries)

8. Domain d1fzoa1: 1fzo A:182-274 [60155]
   Other proteins in same PDB: d1fzoa2

Details for d1fzoa1

PDB Entry: 1fzo, 1.8 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein

SCOP Domain Sequences for d1fzoa1:

Sequence; same for both SEQRES and ATOM records:

>d1fzoa1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d1fzoa1:

• d1fzoa1 first appeared in SCOP 1.57
  
• d1fzoa1 appears in SCOP 1.61
  
• d1fzoa1 appears in the current release, SCOPe 2.08