SCOP 1.67: Domain d1fzma2: 1fzm A:1-181

Lineage for d1fzma2 (1fzm A:1-181)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (34 PDB entries)

8. Domain d1fzma2: 1fzm A:1-181 [60153]
   Other proteins in same PDB: d1fzma1, d1fzmb_
   complexed with fuc, mpd, nag, po4; mutant

Details for d1fzma2

PDB Entry: 1fzm, 1.8 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein

SCOP Domain Sequences for d1fzma2:

Sequence; same for both SEQRES and ATOM records:

>d1fzma2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1fzma2:

• d1fzma2 first appeared in SCOP 1.57
  
• d1fzma2 appears in SCOP 1.65
  
• d1fzma2 appears in SCOP 1.69
  
• d1fzma2 appears in the current release, SCOPe 2.08