Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries) |
Domain d1fzma1: 1fzm A:182-274 [60152] Other proteins in same PDB: d1fzma2, d1fzmb_ |
PDB Entry: 1fzm (more details), 1.8 Å
SCOP Domain Sequences for d1fzma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzma1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d1fzma1: