SCOP 1.75: Domain d1fzkb_: 1fzk B:

Lineage for d1fzkb_ (1fzk B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
   Uniprot P01887

8. Domain d1fzkb_: 1fzk B: [60151]
   Other proteins in same PDB: d1fzka1, d1fzka2
   complexed with fuc, mpd, nag, po4; mutant

Details for d1fzkb_

PDB Entry: 1fzk, 1.7 Å

PDB Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein

PDB Compounds: (B:) protein (beta-2-microglobulin)

SCOP Domain Sequences for d1fzkb_:

Sequence; same for both SEQRES and ATOM records:

>d1fzkb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1fzkb_:

• d1fzkb_ first appeared in SCOP 1.57, called d1fzkb1
  
• d1fzkb_ appears in SCOP 1.73
  
• d1fzkb_ appears in SCOPe 2.01
  
• d1fzkb_ appears in the current release, SCOPe 2.08