Lineage for d1fzkb_ (1fzk B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548300Protein beta2-microglobulin [88600] (4 species)
  7. 548438Species Mouse (Mus musculus) [TaxId:10090] [88603] (66 PDB entries)
  8. 548443Domain d1fzkb_: 1fzk B: [60151]
    Other proteins in same PDB: d1fzka1, d1fzka2
    complexed with fuc, mpd, nag, po4; mutant

Details for d1fzkb_

PDB Entry: 1fzk (more details), 1.7 Å

PDB Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein

SCOP Domain Sequences for d1fzkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzkb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1fzkb_:

Click to download the PDB-style file with coordinates for d1fzkb_.
(The format of our PDB-style files is described here.)

Timeline for d1fzkb_: