Lineage for d1fzif_ (1fzi F:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765254Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 765285Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 765286Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 765287Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 765288Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 765340Domain d1fzif_: 1fzi F: [60145]
    Other proteins in same PDB: d1fzia_, d1fzib_, d1fzic_, d1fzid_
    complexed with fe, xe

Details for d1fzif_

PDB Entry: 1fzi (more details), 3.3 Å

PDB Description: methane monooxygenase hydroxylase, form i pressurized with xenon gas
PDB Compounds: (F:) methane monooxygenase component a, gamma chain

SCOP Domain Sequences for d1fzif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzif_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh

SCOP Domain Coordinates for d1fzif_:

Click to download the PDB-style file with coordinates for d1fzif_.
(The format of our PDB-style files is described here.)

Timeline for d1fzif_: