SCOP 1.75: Domain d1fzhf_: 1fzh F:

Lineage for d1fzhf_ (1fzh F:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)

8. Domain d1fzhf_: 1fzh F: [60139]
   Other proteins in same PDB: d1fzha_, d1fzhb_, d1fzhc_, d1fzhd_
   complexed with ca, fe, xe

Details for d1fzhf_

PDB Entry: 1fzh, 2.6 Å

PDB Description: methane monooxygenase hydroxylase, form ii pressurized with xenon gas

PDB Compounds: (F:) methane monooxygenase component a, gamma chain

SCOP Domain Sequences for d1fzhf_:

Sequence; same for both SEQRES and ATOM records:

>d1fzhf_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

Timeline for d1fzhf_:

• d1fzhf_ first appeared in SCOP 1.57
  
• d1fzhf_ appears in SCOP 1.73
  
• d1fzhf_ appears in SCOPe 2.01
  
• d1fzhf_ appears in the current release, SCOPe 2.08