Lineage for d1fzhe_ (1fzh E:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46401Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies)
  4. 46421Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
  5. 46422Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 46423Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 46424Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)
  8. 46451Domain d1fzhe_: 1fzh E: [60138]
    Other proteins in same PDB: d1fzha_, d1fzhb_, d1fzhc_, d1fzhd_

Details for d1fzhe_

PDB Entry: 1fzh (more details), 2.6 Å

PDB Description: methane monooxygenase hydroxylase, form ii pressurized with xenon gas

SCOP Domain Sequences for d1fzhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzhe_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlq

SCOP Domain Coordinates for d1fzhe_:

Click to download the PDB-style file with coordinates for d1fzhe_.
(The format of our PDB-style files is described here.)

Timeline for d1fzhe_: