Lineage for d1fzhd_ (1fzh D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46831Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 46840Protein Methane monooxygenase hydrolase, beta and alpha subunits [47254] (2 species)
  7. 46841Species Methylococcus capsulatus [TaxId:414] [47255] (15 PDB entries)
  8. 46897Domain d1fzhd_: 1fzh D: [60137]
    Other proteins in same PDB: d1fzhe_, d1fzhf_

Details for d1fzhd_

PDB Entry: 1fzh (more details), 2.6 Å

PDB Description: methane monooxygenase hydroxylase, form ii pressurized with xenon gas

SCOP Domain Sequences for d1fzhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzhd_ a.25.1.2 (D:) Methane monooxygenase hydrolase, beta and alpha subunits {Methylococcus capsulatus}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1fzhd_:

Click to download the PDB-style file with coordinates for d1fzhd_.
(The format of our PDB-style files is described here.)

Timeline for d1fzhd_: