Lineage for d1fzhc_ (1fzh C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 354154Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 354217Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 354218Species Methylococcus capsulatus [TaxId:414] [88793] (15 PDB entries)
  8. 354237Domain d1fzhc_: 1fzh C: [60136]
    Other proteins in same PDB: d1fzha_, d1fzhb_, d1fzhe_, d1fzhf_

Details for d1fzhc_

PDB Entry: 1fzh (more details), 2.6 Å

PDB Description: methane monooxygenase hydroxylase, form ii pressurized with xenon gas

SCOP Domain Sequences for d1fzhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzhc_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1fzhc_:

Click to download the PDB-style file with coordinates for d1fzhc_.
(The format of our PDB-style files is described here.)

Timeline for d1fzhc_: