Lineage for d1fz9f_ (1fz9 F:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96152Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
  4. 96172Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
  5. 96173Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 96174Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 96175Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)
  8. 96197Domain d1fz9f_: 1fz9 F: [60133]
    Other proteins in same PDB: d1fz9a_, d1fz9b_, d1fz9c_, d1fz9d_

Details for d1fz9f_

PDB Entry: 1fz9 (more details), 2.3 Å

PDB Description: Methane monooxygenase hydroxylase, form II cocrystallized with iodoethane

SCOP Domain Sequences for d1fz9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz9f_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph

SCOP Domain Coordinates for d1fz9f_:

Click to download the PDB-style file with coordinates for d1fz9f_.
(The format of our PDB-style files is described here.)

Timeline for d1fz9f_: