SCOP 1.67: Domain d1fz9e_: 1fz9 E:

Lineage for d1fz9e_ (1fz9 E:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)

8. Domain d1fz9e_: 1fz9 E: [60132]
   Other proteins in same PDB: d1fz9a_, d1fz9b_, d1fz9c_, d1fz9d_

Details for d1fz9e_

PDB Entry: 1fz9, 2.3 Å

PDB Description: Methane monooxygenase hydroxylase, form II cocrystallized with iodoethane

SCOP Domain Sequences for d1fz9e_:

Sequence; same for both SEQRES and ATOM records:

>d1fz9e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

Timeline for d1fz9e_:

• d1fz9e_ first appeared in SCOP 1.57
  
• d1fz9e_ appears in SCOP 1.65
  
• d1fz9e_ appears in SCOP 1.69
  
• d1fz9e_ appears in the current release, SCOPe 2.08