Lineage for d1fz8c_ (1fz8 C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441421Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 441484Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 441485Species Methylococcus capsulatus [TaxId:414] [88793] (15 PDB entries)
  8. 441510Domain d1fz8c_: 1fz8 C: [60124]
    Other proteins in same PDB: d1fz8a_, d1fz8b_, d1fz8e_, d1fz8f_

Details for d1fz8c_

PDB Entry: 1fz8 (more details), 2.1 Å

PDB Description: methane monooxygenase hydroxylase, form ii cocrystallized with dibromomethane

SCOP Domain Sequences for d1fz8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz8c_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1fz8c_:

Click to download the PDB-style file with coordinates for d1fz8c_.
(The format of our PDB-style files is described here.)

Timeline for d1fz8c_: