Lineage for d1fz8a_ (1fz8 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212337Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 212362Protein Methane monooxygenase hydrolase, beta and alpha subunits [47254] (2 species)
  7. 212363Species Methylococcus capsulatus [TaxId:414] [47255] (15 PDB entries)
  8. 212396Domain d1fz8a_: 1fz8 A: [60122]
    Other proteins in same PDB: d1fz8e_, d1fz8f_

Details for d1fz8a_

PDB Entry: 1fz8 (more details), 2.1 Å

PDB Description: methane monooxygenase hydroxylase, form ii cocrystallized with dibromomethane
PDB Compounds: (A:)

SCOP Domain Sequences for d1fz8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz8a_ a.25.1.2 (A:) Methane monooxygenase hydrolase, beta and alpha subunits {Methylococcus capsulatus}
nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde
rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng
ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd
avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs
iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi
wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany
pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl
rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli
aqphvrgdklwtlddikrlncvfknpvkafn

SCOP Domain Coordinates for d1fz8a_:

Click to download the PDB-style file with coordinates for d1fz8a_.
(The format of our PDB-style files is described here.)

Timeline for d1fz8a_: