Lineage for d1fz8a_ (1fz8 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96482Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 96483Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 96607Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 96616Protein Methane monooxygenase hydrolase, beta and alpha subunits [47254] (2 species)
  7. 96617Species Methylococcus capsulatus [TaxId:414] [47255] (15 PDB entries)
  8. 96650Domain d1fz8a_: 1fz8 A: [60122]
    Other proteins in same PDB: d1fz8e_, d1fz8f_

Details for d1fz8a_

PDB Entry: 1fz8 (more details), 2.1 Å

PDB Description: methane monooxygenase hydroxylase, form ii cocrystallized with dibromomethane

SCOP Domain Sequences for d1fz8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz8a_ a.25.1.2 (A:) Methane monooxygenase hydrolase, beta and alpha subunits {Methylococcus capsulatus}
nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde
rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng
ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd
avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs
iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi
wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany
pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl
rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli
aqphvrgdklwtlddikrlncvfknpvkafn

SCOP Domain Coordinates for d1fz8a_:

Click to download the PDB-style file with coordinates for d1fz8a_.
(The format of our PDB-style files is described here.)

Timeline for d1fz8a_: