Lineage for d1fx0b1 (1fx0 B:378-485)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282945Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 282946Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 282947Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 282987Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 283023Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88932] (2 PDB entries)
  8. 283024Domain d1fx0b1: 1fx0 B:378-485 [60083]
    Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0a3, d1fx0b2, d1fx0b3

Details for d1fx0b1

PDB Entry: 1fx0 (more details), 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

SCOP Domain Sequences for d1fx0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx0b1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast}
rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata

SCOP Domain Coordinates for d1fx0b1:

Click to download the PDB-style file with coordinates for d1fx0b1.
(The format of our PDB-style files is described here.)

Timeline for d1fx0b1: