Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species) |
Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88778] (2 PDB entries) |
Domain d1fx0a3: 1fx0 A:97-372 [60082] Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0b1, d1fx0b2, d1fx0b3 |
PDB Entry: 1fx0 (more details), 3.2 Å
SCOP Domain Sequences for d1fx0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast} qipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvyeplqtgliaida mipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkassvaqvvtnfqer gameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddlskqaqayrqmsl llrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqagdvsayiptnvi sitdgqiflsadlfnagirpainvgisvsrvgsaaq
Timeline for d1fx0a3: