SCOP 1.69: Domain d1fx0a3: 1fx0 A:97-372

Lineage for d1fx0a3 (1fx0 A:97-372)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88778] (2 PDB entries)

8. Domain d1fx0a3: 1fx0 A:97-372 [60082]
   Other proteins in same PDB: d1fx0a1, d1fx0a2, d1fx0b1, d1fx0b2, d1fx0b3

Details for d1fx0a3

PDB Entry: 1fx0, 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

SCOP Domain Sequences for d1fx0a3:

Sequence; same for both SEQRES and ATOM records:

>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
qipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvyeplqtgliaida
mipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkassvaqvvtnfqer
gameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddlskqaqayrqmsl
llrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqagdvsayiptnvi
sitdgqiflsadlfnagirpainvgisvsrvgsaaq

Timeline for d1fx0a3:

• d1fx0a3 first appeared in SCOP 1.57
  
• d1fx0a3 appears in SCOP 1.67
  
• d1fx0a3 appears in SCOP 1.71
  
• d1fx0a3 appears in the current release, SCOPe 2.08