SCOPe 2.07: Domain d1fx0a2: 1fx0 A:25-96

Lineage for d1fx0a2 (1fx0 A:25-96)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88676] (2 PDB entries)

8. Domain d1fx0a2: 1fx0 A:25-96 [60081]
   Other proteins in same PDB: d1fx0a1, d1fx0a3, d1fx0b1, d1fx0b2, d1fx0b3

Details for d1fx0a2

PDB Entry: 1fx0, 3.2 Å

PDB Description: crystal structure of the chloroplast f1-atpase from spinach

PDB Compounds: (A:) ATP synthase alpha chain

SCOPe Domain Sequences for d1fx0a2:

Sequence; same for both SEQRES and ATOM records:

>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
egssvkatgria

Timeline for d1fx0a2:

• d1fx0a2 first appeared in SCOP 1.57
  
• d1fx0a2 appears in SCOPe 2.06
  
• d1fx0a2 appears in the current release, SCOPe 2.08