Class a: All alpha proteins [46456] (284 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88927] (2 PDB entries) |
Domain d1fx0a1: 1fx0 A:373-501 [60080] Other proteins in same PDB: d1fx0a2, d1fx0a3, d1fx0b1, d1fx0b2, d1fx0b3 |
PDB Entry: 1fx0 (more details), 3.2 Å
SCOPe Domain Sequences for d1fx0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx0a1 a.69.1.1 (A:373-501) F1 ATP synthase alpha subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} ikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqsapltve eqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktfteeaeallke aiqeqmerf
Timeline for d1fx0a1: