SCOPe 2.05: Domain d1fwxd2: 1fwx D:10-451

Lineage for d1fwxd2 (1fwx D:10-451)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family)

5. Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (2 proteins)

6. Protein Nitrous oxide reductase, N-terminal domain [50976] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [63833] (1 PDB entry)

8. Domain d1fwxd2: 1fwx D:10-451 [60076]
   Other proteins in same PDB: d1fwxa1, d1fwxb1, d1fwxc1, d1fwxd1
   complexed with ca, cl, cua, cuz

Details for d1fwxd2

PDB Entry: 1fwx, 1.6 Å

PDB Description: crystal structure of nitrous oxide reductase from p. denitrificans

PDB Compounds: (D:) nitrous oxide reductase

SCOPe Domain Sequences for d1fwxd2:

Sequence; same for both SEQRES and ATOM records:

>d1fwxd2 b.69.3.1 (D:10-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}
gsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvriher
tmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmkc
daileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdadk
wevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeieka
iaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtvl
dvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwniedair
ayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpend
qlidisgdkmvlvhdgptfaephdaiavhpsilsdik

Timeline for d1fwxd2:

• d1fwxd2 first appeared in SCOP 1.57
  
• d1fwxd2 appears in SCOPe 2.04
  
• d1fwxd2 appears in SCOPe 2.06
  
• d1fwxd2 appears in the current release, SCOPe 2.08