![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.4: Nitrosocyanin [63392] (2 proteins) |
![]() | Protein Nitrous oxide reductase, C-terminal domain [49548] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [63690] (1 PDB entry) |
![]() | Domain d1fwxc1: 1fwx C:452-581 [60073] Other proteins in same PDB: d1fwxa2, d1fwxb2, d1fwxc2, d1fwxd2 complexed with ca, cl, cua, cuz |
PDB Entry: 1fwx (more details), 1.6 Å
SCOPe Domain Sequences for d1fwxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwxc1 b.6.1.4 (C:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} svwdrndpmwaetraqaeadgvdidnwteevirdgnkvrvymssvapsfsiesftvkegd evtvivtnldeiddlthgftmgnygvameigpqmtssvtfvaanpgvywyycqwfchalh memrgrmlvepk
Timeline for d1fwxc1: