SCOP 1.61: Domain d1fwxc1: 1fwx C:452-581

Lineage for d1fwxc1 (1fwx C:452-581)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)

6. Protein Nitrous oxide reductase, C-terminal domain [49548] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [63690] (1 PDB entry)

8. Domain d1fwxc1: 1fwx C:452-581 [60073]
   Other proteins in same PDB: d1fwxa2, d1fwxb2, d1fwxc2, d1fwxd2

Details for d1fwxc1

PDB Entry: 1fwx, 1.6 Å

PDB Description: crystal structure of nitrous oxide reductase from p. denitrificans

SCOP Domain Sequences for d1fwxc1:

Sequence; same for both SEQRES and ATOM records:

>d1fwxc1 b.6.1.4 (C:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans}
svwdrndpmwaetraqaeadgvdidnwteevirdgnkvrvymssvapsfsiesftvkegd
evtvivtnldeiddlthgftmgnygvameigpqmtssvtfvaanpgvywyycqwfchalh
memrgrmlvepk

Timeline for d1fwxc1:

• d1fwxc1 first appeared in SCOP 1.57
  
• d1fwxc1 appears in SCOP 1.59
  
• d1fwxc1 appears in SCOP 1.63
  
• d1fwxc1 appears in the current release, SCOPe 2.08