Lineage for d1fwta_ (1fwt A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572455Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 572812Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 572889Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (3 species)
  7. 572890Species Aquifex aeolicus [TaxId:63363] [63922] (16 PDB entries)
  8. 572909Domain d1fwta_: 1fwt A: [60065]

Details for d1fwta_

PDB Entry: 1fwt (more details), 1.9 Å

PDB Description: aquifex aeolicus kdo8p synthase in complex with pep, e4p and cadmium

SCOP Domain Sequences for d1fwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwta_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti

SCOP Domain Coordinates for d1fwta_:

Click to download the PDB-style file with coordinates for d1fwta_.
(The format of our PDB-style files is described here.)

Timeline for d1fwta_: