Lineage for d1fvza_ (1fvz A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334179Fold d.129: TBP-like [55944] (4 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 334326Superfamily d.129.3: Bet v1-like [55961] (4 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 334376Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (1 protein)
  6. 334377Protein Phoshatidylinositol transfer protein, PITP [64389] (2 species)
  7. 334380Species Rat (Rattus norvegicus) [TaxId:10116] [64390] (1 PDB entry)
  8. 334381Domain d1fvza_: 1fvz A: [60050]
    complexed to phosphatidylcholine
    complexed with pc2

Details for d1fvza_

PDB Entry: 1fvz (more details), 2.2 Å

PDB Description: the structure of pitp complexed to phosphatidylcholine

SCOP Domain Sequences for d1fvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvza_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Rat (Rattus norvegicus)}
vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveviyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqldemrqkdpvkgmtad

SCOP Domain Coordinates for d1fvza_:

Click to download the PDB-style file with coordinates for d1fvza_.
(The format of our PDB-style files is described here.)

Timeline for d1fvza_: