Lineage for d1fvza_ (1fvz A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.129: TBP-like [55944] (4 superfamilies) 
Superfamily d.129.3: Bet v1-like [55961] (4 families) 
Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (1 protein) Protein Phoshatidylinositol transfer protein, PITP [64389] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [64390] (1 PDB entry) 
Domain d1fvza_: 1fvz A: [60050]
Details for d1fvza_
PDB Entry: 1fvz (more details), 2.2 Å
PDB Description: the structure of pitp complexed to phosphatidylcholine
SCOP Domain Sequences for d1fvza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvza_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Rat (Rattus norvegicus)}
vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveviyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqldemrqkdpvkgmtad
SCOP Domain Coordinates for d1fvza_:
Click to download the PDB-style file with coordinates for d1fvza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fvza_:
- d1fvza_ is new in SCOP 1.57
- d1fvza_ appears in SCOP 1.59
- d1fvza_ last appears in SCOP 1.65
View in 3D