Lineage for d1fvqa1 (1fvq A:2-72)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560728Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2560729Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2560813Protein Copper transporter domain ccc2a [64279] (1 species)
  7. 2560814Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (3 PDB entries)
  8. 2560816Domain d1fvqa1: 1fvq A:2-72 [60046]
    Other proteins in same PDB: d1fvqa2
    apo form

Details for d1fvqa1

PDB Entry: 1fvq (more details)

PDB Description: solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) loaded states
PDB Compounds: (A:) copper-transporting ATPase

SCOPe Domain Sequences for d1fvqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvqa1 d.58.17.1 (A:2-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
revilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiied
cgfdceilrds

SCOPe Domain Coordinates for d1fvqa1:

Click to download the PDB-style file with coordinates for d1fvqa1.
(The format of our PDB-style files is described here.)

Timeline for d1fvqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fvqa2