SCOPe 2.08: Domain d1fuxb1: 1fux B:1-162

Lineage for d1fuxb1 (1fux B:1-162)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 proteins)
   automatically mapped to Pfam PF01161

6. Protein Hypothetical protein YbcL [63704] (1 species)

7. Species Escherichia coli [TaxId:562] [63705] (1 PDB entry)

8. Domain d1fuxb1: 1fux B:1-162 [60035]
   Other proteins in same PDB: d1fuxa2, d1fuxa3, d1fuxb2

Details for d1fuxb1

PDB Entry: 1fux, 1.81 Å

PDB Description: crystal structure of e.coli ybcl, a new member of the mammalian pebp family

PDB Compounds: (B:) hypothetical 19.5 kda protein in emre-rus intergenic region

SCOPe Domain Sequences for d1fuxb1:

Sequence; same for both SEQRES and ATOM records:

>d1fuxb1 b.17.1.2 (B:1-162) Hypothetical protein YbcL {Escherichia coli [TaxId: 562]}
fqvtsneiktgeqlttshvfsgfgceggntspsltwsgvpegtksfavtvydpdaptgsg
wwhwtvvnipatvtylpvdagrrdgtklptgavqgrndfgyagfggacppkgdkphhyqf
kvwalktekipvdsnssgalvgymlnankiataeitpvyeik

Timeline for d1fuxb1:

• d1fuxb1 first appeared in SCOP 1.57, called d1fuxb_
  
• d1fuxb1 appears in SCOPe 2.07