SCOPe 2.06: Domain d1fsyb_: 1fsy B:

Lineage for d1fsyb_ (1fsy B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (101 PDB entries)

8. Domain d1fsyb_: 1fsy B: [60017]
   complexed with 105, po4

Details for d1fsyb_

PDB Entry: 1fsy, 1.75 Å

PDB Description: ampc beta-lactamase from e. coli complexed with inhibitor cloxacillinboronic acid

PDB Compounds: (B:) cephalosporinase

SCOPe Domain Sequences for d1fsyb_:

Sequence; same for both SEQRES and ATOM records:

>d1fsyb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnala

Timeline for d1fsyb_:

• d1fsyb_ first appeared in SCOP 1.57
  
• d1fsyb_ appears in SCOPe 2.05
  
• d1fsyb_ appears in SCOPe 2.07
  
• d1fsyb_ appears in the current release, SCOPe 2.08