Lineage for d1fsya_ (1fsy A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949301Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1949342Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (97 PDB entries)
  8. 1949409Domain d1fsya_: 1fsy A: [60016]
    complexed with 105, po4

Details for d1fsya_

PDB Entry: 1fsy (more details), 1.75 Å

PDB Description: ampc beta-lactamase from e. coli complexed with inhibitor cloxacillinboronic acid
PDB Compounds: (A:) cephalosporinase

SCOPe Domain Sequences for d1fsya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsya_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnala

SCOPe Domain Coordinates for d1fsya_:

Click to download the PDB-style file with coordinates for d1fsya_.
(The format of our PDB-style files is described here.)

Timeline for d1fsya_: