Lineage for d1fsxd_ (1fsx D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436496Protein Hemoglobin, beta-chain [46500] (20 species)
  7. 436520Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)
  8. 436528Domain d1fsxd_: 1fsx D: [60015]
    Other proteins in same PDB: d1fsxa_, d1fsxc_

Details for d1fsxd_

PDB Entry: 1fsx (more details), 2.1 Å

PDB Description: the x-ray structure determination of bovine carbonmonoxy hb at 2.1 a resolution and its relationship to the quaternary structure of other hb crystal forms

SCOP Domain Sequences for d1fsxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsxd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Cow (Bos taurus)}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d1fsxd_:

Click to download the PDB-style file with coordinates for d1fsxd_.
(The format of our PDB-style files is described here.)

Timeline for d1fsxd_: