Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (18 species) |
Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries) |
Domain d1fsxd_: 1fsx D: [60015] Other proteins in same PDB: d1fsxa_, d1fsxc_ complexed with cmo, hem |
PDB Entry: 1fsx (more details), 2.1 Å
SCOP Domain Sequences for d1fsxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsxd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Cow (Bos taurus)} mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke ftpvlqadfqkvvagvanalahryh
Timeline for d1fsxd_: