SCOP 1.71: Domain d1fsxc_: 1fsx C:

Lineage for d1fsxc_ (1fsx C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46490] (5 PDB entries)

8. Domain d1fsxc_: 1fsx C: [60014]
   Other proteins in same PDB: d1fsxb_, d1fsxd_
   complexed with cmo, hem

Details for d1fsxc_

PDB Entry: 1fsx, 2.1 Å

PDB Description: the x-ray structure determination of bovine carbonmonoxy hb at 2.1 a resolution and its relationship to the quaternary structure of other hb crystal forms

SCOP Domain Sequences for d1fsxc_:

Sequence; same for both SEQRES and ATOM records:

>d1fsxc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus)}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

Timeline for d1fsxc_:

• d1fsxc_ first appeared in SCOP 1.57
  
• d1fsxc_ appears in SCOP 1.69
  
• d1fsxc_ appears in SCOP 1.73
  
• d1fsxc_ appears in the current release, SCOPe 2.08