Lineage for d1fsxc_ (1fsx C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 148233Family a.1.1.2: Globins [46463] (18 proteins)
  6. 148338Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 148359Species Cow (Bos taurus) [TaxId:9913] [46490] (5 PDB entries)
  8. 148367Domain d1fsxc_: 1fsx C: [60014]
    Other proteins in same PDB: d1fsxb_, d1fsxd_

Details for d1fsxc_

PDB Entry: 1fsx (more details), 2.1 Å

PDB Description: the x-ray structure determination of bovine carbonmonoxy hb at 2.1 a resolution and its relationship to the quaternary structure of other hb crystal forms

SCOP Domain Sequences for d1fsxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsxc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus)}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOP Domain Coordinates for d1fsxc_:

Click to download the PDB-style file with coordinates for d1fsxc_.
(The format of our PDB-style files is described here.)

Timeline for d1fsxc_: