Lineage for d1fsxb_ (1fsx B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759043Species Cow (Bos taurus) [TaxId:9913] [46506] (8 PDB entries)
  8. 759050Domain d1fsxb_: 1fsx B: [60013]
    Other proteins in same PDB: d1fsxa_, d1fsxc_

Details for d1fsxb_

PDB Entry: 1fsx (more details), 2.1 Å

PDB Description: the x-ray structure determination of bovine carbonmonoxy hb at 2.1 a resolution and its relationship to the quaternary structure of other hb crystal forms
PDB Compounds: (B:) hemoglobin beta chain

SCOP Domain Sequences for d1fsxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsxb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d1fsxb_:

Click to download the PDB-style file with coordinates for d1fsxb_.
(The format of our PDB-style files is described here.)

Timeline for d1fsxb_: