SCOP 1.73: Domain d1fsxb_: 1fsx B:

Lineage for d1fsxb_ (1fsx B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (22 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)

8. Domain d1fsxb_: 1fsx B: [60013]
   Other proteins in same PDB: d1fsxa_, d1fsxc_

Details for d1fsxb_

PDB Entry: 1fsx, 2.1 Å

PDB Description: the x-ray structure determination of bovine carbonmonoxy hb at 2.1 a resolution and its relationship to the quaternary structure of other hb crystal forms

PDB Compounds: (B:) hemoglobin beta chain

SCOP Domain Sequences for d1fsxb_:

Sequence; same for both SEQRES and ATOM records:

>d1fsxb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

Timeline for d1fsxb_:

• d1fsxb_ first appeared in SCOP 1.57
  
• d1fsxb_ appears in SCOP 1.71
  
• d1fsxb_ appears in SCOP 1.75
  
• d1fsxb_ appears in the current release, SCOPe 2.08