Lineage for d1fswb_ (1fsw B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2568487Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2568529Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (109 PDB entries)
  8. 2568639Domain d1fswb_: 1fsw B: [60011]
    complexed with ctb, po4

Details for d1fswb_

PDB Entry: 1fsw (more details), 1.9 Å

PDB Description: ampc beta-lactamase from e. coli complexed with inhibitor cephalothinboronic acid
PDB Compounds: (B:) cephalosporinase

SCOPe Domain Sequences for d1fswb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fswb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnala

SCOPe Domain Coordinates for d1fswb_:

Click to download the PDB-style file with coordinates for d1fswb_.
(The format of our PDB-style files is described here.)

Timeline for d1fswb_: