SCOPe 2.04: Domain d1fswa_: 1fsw A:

Lineage for d1fswa_ (1fsw A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (95 PDB entries)

8. Domain d1fswa_: 1fsw A: [60010]
   complexed with ctb, po4

Details for d1fswa_

PDB Entry: 1fsw, 1.9 Å

PDB Description: ampc beta-lactamase from e. coli complexed with inhibitor cephalothinboronic acid

PDB Compounds: (A:) cephalosporinase

SCOPe Domain Sequences for d1fswa_:

Sequence; same for both SEQRES and ATOM records:

>d1fswa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnala

Timeline for d1fswa_:

• d1fswa_ first appeared in SCOP 1.57
  
• d1fswa_ appears in SCOPe 2.03
  
• d1fswa_ appears in SCOPe 2.05
  
• d1fswa_ appears in the current release, SCOPe 2.08